Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

406 – 420 of 1,444,027 results

406

Invitrogen™ THRA/THRB Monoclonal Antibody (C3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Gel Shift,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P10827, P10828
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	THRA/THRB
Gene Symbols	THRA, THRB
Regulatory Status	RUO
Gene Alias	6430529J03Rik; AR7; AW259572; c-erbA-1; C-ERBA-2; c-erbAalpha; c-erbA-alpha; C-ERBA-BETA; CHNG6; EAR7; EAR-7; Erba; ERBA1; ERBA2; ERBA-related 7; ERB-T-1; GRTH; Nr1a1; NR1A2; Nuclear receptor subfamily 1 group A member 1; nuclear receptor subfamily 1 group A member 2; oncogene ERBA2; PRTH; Rvr; T3R[a]; T3Ralpha; THR; THR1; THRA; THRA1; THRA2; THRB; THRB1; THRB2; thyroid hormone nuclear receptor beta variant 1; thyroid hormone receptor alpha; thyroid hormone receptor alpha 1; thyroid hormone receptor beta; thyroid hormone receptor, alpha; thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian); thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian); thyroid normone nuclear receptor alpha variant 1; TR; TR alpha 1; TR alpha 2; triiodothyronine receptor; V-erbA-related protein 7
Gene	THRA
Product Type	Antibody
Gene ID (Entrez)	7067, 7068
Formulation	Ascites with 0.05% sodium azide
Immunogen	Purified fragment of human TR beta-1 corresponding to residues 201-456.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C3

407

Invitrogen™ Phospho-Histone H2A.X (Ser139) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Zebrafish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P16104, P27661, Q7ZUY3
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	Phospho-Histone H2A.X (Ser139)
Gene Symbols	H2AX
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AW228881; gamma H2AX; gammaH2ax; H2A histone family member X; H2A histone family, member X; H2A.X; H2A.X variant histone; H2A/X; h2afx; H2ax; H2AX histone; Hist5-2ax; histone 5 protein 2ax; histone H2A.x; Histone H2a/x; Histone H2AX; RGD1566119; similar to H2A histone family, member X; zgc:56329
Gene	H2AX
Product Type	Antibody
Gene ID (Entrez)	15270, 3014, 394048, 500987
Formulation	PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide surrounding phospho Ser139 of human Histone H2A.X. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

408

Invitrogen™ Phospho-ATR (Thr1989) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q13535, Q9JKK8
Isotype	IgG
Concentration	0.07 mg/mL
Antigen	Phospho-ATR (Thr1989)
Gene Symbols	ATR
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2310008J16Rik; 2810405N18Rik; ataxia telangiectasia and Rad3 related; ataxia telangiectasia and Rad3-related protein; ATR; ATR serine/threonine kinase; EC 2.7.11.1; FCTCS; FRAP-related protein 1; FRAP-related protein-1; FRP1; I79_000761; kinase ATR; MEC1; MEC1, mitosis entry checkpoint 1, homolog; protein kinase ATR; SCKL; SCKL1; Serine/threonine-protein kinase ATR; TEM8
Gene	ATR
Product Type	Antibody
Gene ID (Entrez)	245000, 545
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide surrounding phospho Thr1989 of human ATR. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

409

Invitrogen™ BSEP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O70127, O95342, Q9QY30
Isotype	IgG
Concentration	500 μg/mL
Antigen	BSEP
Gene Symbols	ABCB11
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ABC member 16, MDR/TAP subfamily; ABC16; Abcb11; ATP binding cassette subfamily B member 11; ATP-binding cassette sub-family B member 11; ATP-binding cassette, subfamily B (MDR/TAP), member 11; ATP-binding cassette, sub-family B (MDR/TAP), member 11; ATP-binding cassette, sub-family B, member 11; bile salt export pump; BRIC2; Bsep; Lith1; PFIC2; PFIC-2; PGY4; progressive familial intrahepatic cholestasis 2; sister of P-glycoprotein; sister p-glycoprotein; Spgp
Gene	ABCB11
Product Type	Antibody
Gene ID (Entrez)	27413, 83569, 8647
Formulation	PBS with 5mg BSA and 0.01mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB11 (1175-1199aa KYGDNTKEIPMERVIAAAKQAQLHD).
Classification	Polyclonal
Primary or Secondary	Primary

410

Invitrogen™ Podocin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q8K4G9, Q91X05, Q9NP85
Isotype	IgG
Concentration	500 μg/mL
Antigen	Podocin
Gene Symbols	Nphs2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI790225; nephrosis 2 homolog, podocin; nephrosis 2 idiopathic steroid-resistant (podocin); nephrosis 2, idiopathic, steroid-resistant; nephrosis 2, idiopathic, steroid-resistant (podocin); nephrosis 2, podocin; NPHS2; NPHS2 podocin; NPHS2 stomatin family member, podocin; NPHS2, podocin; PDCN; podocin; SRN1
Gene	Nphs2
Product Type	Antibody
Gene ID (Entrez)	170484, 170672, 7827
Formulation	PBS with 5mg BSA and 0.05mg thimerosal, 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human NPHS2 (368-383aa KPVEPLNPKKKDSPML).
Classification	Polyclonal
Primary or Secondary	Primary

411

Invitrogen™ GLP-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Lyophilized
Gene Accession No.	P01275, P06883, P55095
Isotype	IgG
Concentration	500 μg/mL
Antigen	GLP-1
Gene Symbols	GCG
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon like peptide 1; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; Incretin hormone; MGC138331; OXM; OXY; Oxyntomodulin; PPG; preproglucagon
Gene	GCG
Product Type	Antibody
Gene ID (Entrez)	14526, 24952, 2641
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human GLP1 (53-81aa HSQGTFTSDYSKYLDSRRAQDFVQWLMNT).
Classification	Polyclonal
Primary or Secondary	Primary

412

Invitrogen™ Caveolin 3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P51637, P51638, P56539
Isotype	IgG
Concentration	1 mg/mL
Antigen	Caveolin 3
Gene Symbols	Cav3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI385751; CAV; Cav3; Cav-3; caveolin 3; caveolin-3; LGMD1C; LQT9; M-cav; M-caveolin; MGC126100; MGC126101; MGC126129; structural protein; VIP21; VIP-21
Gene	Cav3
Product Type	Antibody
Gene ID (Entrez)	12391, 29161, 859
Formulation	PBS with 1 mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues M(1) M T E E H T D L E A R I I K D I H C(19) C of mouse CAV3.
Classification	Polyclonal
Primary or Secondary	Primary

413

Invitrogen™ NFAT5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Gel Shift,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O94916, Q9WV30
Isotype	IgG
Concentration	1 mg/mL
Antigen	NFAT5
Gene Symbols	NFAT5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI225870; B130038B15Rik; CAG-8; CAG80; glutamine rich protein H65; KIAA0827; mKIAA0827; Nfat; Nfat5; NF-AT5; NFATL1; NFAT-like protein 1; nfatz; nuclear factor of activated T cells 5; nuclear factor of activated T-cells 5; nuclear factor of activated T-cells 5, tonicity-responsive; OREBP; osmotic response element-binding protein; rel domain-containing transcription factor NFAT5; T-cell transcription factor NFAT5; TonE-binding protein; TONEBP; tonicity-responsive enhancer binding protein; tonicity-responsive enhancer-binding protein
Gene	NFAT5
Product Type	Antibody
Gene ID (Entrez)	10725, 54446
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues C D(1439) L L V S L Q N Q G N N L T G S F(1455) of human NFAT5.
Classification	Polyclonal
Primary or Secondary	Primary

414

Invitrogen™ CYP11B2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P15539, P19099, P30099
Isotype	IgG
Concentration	1 mg/mL
Antigen	CYP11B2
Gene Symbols	CYP11B2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ALDOS; Aldosterone synthase; aldosterone-synthesizing enzyme; Corticosterone 18-monooxygenase, CYP11B2; Cp45as; Cpn2; Cyp11b; CYP11B2; Cyp11b-2; Cyp11b3; CYP11BL; CYPXIB2; CYPXIB3; cytochrome P450 11B2, mitochondrial; cytochrome P450 11B3, mitochondrial; cytochrome P450 family 11 subfamily B member 2; Cytochrome P450 subfamily XIB polypeptide 2 (aldosterone synthase); cytochrome P450, family 11, subfamily b, polypeptide 2; cytochrome P450, subfamily 11B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; Cytochrome P450, subfamily XIB, polypeptide 2 (aldosterone synthase); cytochrome P-450Aldo; cytochrome P450-Aldo-1; cytochrome P450-Aldo-2; cytochrome P450C11; Cytochrome P-450C18; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; P450aldo; P450-Aldo-1; P450-Aldo-2; P450C 18; P-450C 18; P450C18; P-450C18; RNCP45AS; steroid 11-beta/18-hydroxylase; steroid 11-beta-hydroxylase; Steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo; steroid-11-beta-hydroxylase
Gene	CYP11B2
Product Type	Antibody
Gene ID (Entrez)	13072, 1585, 24294
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human CYP11B2(Accession P19099), corresponding to amino acid residues M309-T359.
Classification	Polyclonal
Primary or Secondary	Primary

415

Invitrogen™ CD8 Monoclonal Antibody (4B11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P01732, P10966
Isotype	IgG2b
Concentration	Conc. Not Determined
Antigen	CD8
Gene Symbols	Cd8a, CD8B
Regulatory Status	RUO
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	Cd8a
Product Type	Antibody
Gene ID (Entrez)	925, 926
Formulation	Tissue culture supernatant with <0.1% sodium azide
Immunogen	Synthetic peptide derived from the carboxy terminal region of the human CD8 alpha chain coupled to a N-terminal cysteine, with the sequence C-KSDGKPSLSARYV (amino acid range 223-235). The peptide was coupled to bovine serum albumin and keyhole limpet hemocyanin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4B11

416

Invitrogen™ 6x-His Tag Monoclonal Antibody (AD1.1.10), HRP

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Tag
Host Species	Mouse
Conjugate	HRP
Applications	ELISA,Western Blot
Form	Liquid
Isotype	IgG1
Concentration	1 mg/mL
Antigen	6x-His Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	6His tag; 6X His; His Tag; Histidine Tag
Product Type	Antibody
Formulation	PBS with 0.0095% Methylisothiazolone; pH 7.4
Immunogen	PAX6 transcription factor linked to histidine tag.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AD1.1.10

417

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Tag
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	V5 Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	simian virus 5 antibody; SPV5gp2; sv5; V5; v-5; V5 Epitope Tag
Product Type	Antibody
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	V5 synthetic peptide: Gly-Lys-Pro-Ile-Pro-Asn-Pro-Leu-Leu-Gly-Leu-Asp-Ser-Thr.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11F7

418

Invitrogen™ MCP-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	P10148, P13500, P14844
Isotype	IgG
Concentration	1 mg/mL
Antigen	MCP-1
Gene Symbols	Ccl2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Acidic seminal fluid protein; AI323594; C-C motif chemokine 2; C-C motif chemokine ligand 2; Ccl2; chemokine (C-C motif) ligand 2; GDCF-2; HC11; H-MCP-1; HSMCR30; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; Je; MCAF; Mcp1; MCP-1; MCP1A; MCP-1A; MGC9434; Monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; monocyte chemotactic protein 1A; Monocyte secretory protein JE; monocyte-chemoattractant protein-1 precursor; platelet-derived growth factor-inducible protein JE; RP23-350G1.3; SCYA2; Sigje; small inducible cytokine A2; small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je); small inducible cytokine subfamily A (Cys-Cys), member 2; small inducible gene JE; small-inducible cytokine A2; SMC-CF
Gene	Ccl2
Product Type	Antibody
Gene ID (Entrez)	20296, 24770, 6347
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide near the carboxy terminus of human CCL2.
Classification	Polyclonal
Primary or Secondary	Primary

419

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Ultra Violet™ 395, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Rat
Conjugate	Brilliant Ultraviolet 395
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P22301
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	IL-10
Gene Symbols	IL10
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF
Gene	IL10
Product Type	Antibody
Gene ID (Entrez)	3586
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JES3-9D7

420

Invitrogen™ AMHR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	Q16671, Q62893, Q8K592
Isotype	IgG
Concentration	500 μg/mL
Antigen	AMHR2
Gene Symbols	AMHR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AMH type II receptor; AMHR; Amhr2; Anti-Muellerian hormone type II receptor; anti-Muellerian hormone type-2 receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor type 2; anti-Mullerian hormone receptor type II; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; anti-Mullerian hormone type 2 receptor delta 2; anti-Mullerian hormone type 2 receptor delta 9/10; C14; MIS type II receptor; Misiir; MISR2; MISRII; MRII; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor
Gene	AMHR2
Product Type	Antibody
Gene ID (Entrez)	110542, 269, 29530
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE).
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
26
27
28
29
...
96,269
Next

Welcome to fishersci.com

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ THRA/THRB Monoclonal Antibody (C3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-Histone H2A.X (Ser139) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-ATR (Thr1989) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BSEP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Podocin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GLP-1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Caveolin 3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NFAT5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP11B2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD8 Monoclonal Antibody (4B11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ 6x-His Tag Monoclonal Antibody (AD1.1.10), HRP Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MCP-1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Ultra Violet™ 395, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AMHR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ THRA/THRB Monoclonal Antibody (C3)

Invitrogen™ Phospho-Histone H2A.X (Ser139) Polyclonal Antibody

Invitrogen™ Phospho-ATR (Thr1989) Polyclonal Antibody

Invitrogen™ BSEP Polyclonal Antibody

Invitrogen™ Podocin Polyclonal Antibody

Invitrogen™ GLP-1 Polyclonal Antibody

Invitrogen™ Caveolin 3 Polyclonal Antibody

Invitrogen™ NFAT5 Polyclonal Antibody

Invitrogen™ CYP11B2 Polyclonal Antibody

Invitrogen™ CD8 Monoclonal Antibody (4B11)

Invitrogen™ 6x-His Tag Monoclonal Antibody (AD1.1.10), HRP

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488

Invitrogen™ MCP-1 Polyclonal Antibody

Invitrogen™ IL-10 Monoclonal Antibody (JES3-9D7), Brilliant Ultra Violet™ 395, eBioscience™

Invitrogen™ AMHR2 Polyclonal Antibody